Từ điển
Dịch văn bản
 
Tất cả từ điển
Tra từ
Hỏi đáp nhanh
 
 
 
Kết quả
Thêm nôi dung
5 Đóng góp
JungHyunRan09/04/2014 14:49:55
(1)|
take
Từ điển Anh - Việt
take (teikverb – past tense took (tuk) past participle taken –
1. (often with down, ~out etc) to reach out for and grasp, hold, lift, pull etcHe took my hand; He took the book down from the shelf; He opened the drawer and took out a gun; I've had a tooth taken out. cầm, nắm
2. (often with away, ~in, ~off, ~out etc) to carry, conduct or lead to another place. I took the books (back) to the library; He's taking me with him; Take her into my office; The police took him away; I took the dog out for a walk; He took her out for dinner.đem đi, lấy đi
3. to do or perform some action. I think I'll take a walk; Will you take a look?; to take a bath làm, nhìn ngắm
4. to get, receive, buy, rent etcI'm taking French lessons; I'll take three kilos of strawberries; We took a house in London. nhận, mua, bán
5. (sometimes with back) to agree to have; to accept; He took my advice They refused to take responsibility I won't take that(insultfrom you! I'm afraid we can't take back goods bought in a sale đồng ý nhận
6. to need or require. How long does it take you to go home?; It takes time to do a difficult job like this. cần
7. to travel by (bus etc). I'm taking the next train to London; I took a taxi. đi
8. to have enough space for. The car takes five people. chứa được
9. to make a note, record etcHe took a photograph of the castle; The nurse took the patient's temperature. ghi chép, chụp ảnh
10. to remove, use, occupy etc with or without permission. Someone's taken my coat; He took all my money. lấy, dùng
11. to consider (as an example). Take John for example. lấy làm ví dụ
12. to capture or win. He took the first prize. đạt được
13. (often with away, ~from, ~off) to make less or smaller by a certain amount. Take (away) four from ten, and that leaves six.trừ đi
14. to suppose or think (that something is the case). Do you take me for an idiot? nghĩ rằng, cho rằng
15. to eat or drink. Take these pills. ăn uống
16. to conduct, lead or run; to be in charge or control of. Will you take the class/lecture/meeting this evening? học, ứng xử
17. to consider or react or behave to (something) in a certain way. He took the news calmly. tiếp nhận, phản ứng
18. to feel. He took pleasure/pride / a delight / an interest in his work. cảm thấy
19. to go down or go into (a road). Take the second road on the left. đi vào
noun
1. the amount of money taken in a shop etc; takings. What was the take today? số tiền thu được
2. the filming of a single scene in a cinema film. After five takes, the director was satisfied. cảnh quay
taker noun
a person who takes (something) especially one who accepts an offer or takes a bet. I offered my friends my car, but there were no takers. người đánh cuộc
takings noun plural
the amount of money taken at a concert, in a shop etcthe day's takings. số tiền thu được
ˈtake-away noun
(American ˈcarry-out or ˈtake-out).
1. food prepared and bought in a restaurant but taken away and eaten somewhere else eg at home. I'll go and buy a take-away;(also adjective) a take-away meal. thức ăn mang về
2. a restaurant where such food is prepared and bought. cửa hàng bán thức ăn mang về
be taken up with
to be busy or occupied with. He's very taken up with his new job. bận rộn
be taken with/by
to find pleasing or attractive. He was very taken with the village. thích thú
take after
to be like (someone, especially a parent or relation) in appearance or character. She takes after her father. giống
take back
1. to make (someone) remember or think about (something). Meeting my old friends took me back to my childhood. giúp hồi tưởng lại
2. to admit that what one has said is not true. Take back what you said about my sister! rút lại
take down
to make a note or record of. He took down her name and address. ghi chép
take an examination/test
to have one's knowledge or ability tested formally, often in writing. thi
take (someone) for
to believe (mistakenly) that (someone) is (someone or something else). I took you for your brother. nhầm
take in
1. to include. Literature takes in drama, poetry and the novel. bao gồm
2. to give (someone) shelter. He had nowhere to go, so I took him in. che chở
3. to understand and remember. I didn't take in what he said. hiểu, nhớ
4. to make (clothes) smaller. I lost a lot of weight, so I had to take all my clothes in. làm nhỏ đi
5. to deceive or cheat. He took me in with his story. lừa lọc
take it from me (that)
you can believe me when I say (that). Take it from me – it's true. hãy tin tôi
take it into one's head (to)
to decide (to). She took it into her head to go to Spain. quyết định
take off
1. to remove (clothes etc). He took off his coat. cởi
2. (of an aircraft) to leave the ground. The plane took off for Rome (noun ˈtake-off). cất cánh
3. not to work during (a period of time). I'm taking tomorrow morning off. được nghỉ
4. to imitate someone (often unkindly). He used to take off his teacher to make his friends laugh (noun ˈtake-off). bắt chước
take on
1. to agree to do (work etc); to undertake. He took on the job. đồng ý
2. to employ. They are taking on five hundred more men at the factory. thuê, tuyển nhân viên
3. (with at) to challenge (someone) to a game etcI'll take you on at tennis. khiếu nại
4. to get; to assume. His writing took on a completely new meaning. mang ý nghĩa
5. to allow (passengers) to get on or in. The bus only stops here to take on passengers. đón khách
6. to be upset. Don't take on so! buồn rầu
take it out on
to be angry with or unpleasant to because one is angry, disappointed etc oneself. You're upset, but there's no need to take it out on me! giận dữ
take over
1. to take control (of). He has taken the business over (noun ˈtake-over). chiếm
2. (often with from) to do (something) after someone else stops doing it. He retired last year, and I took over (his job) from him.tiếp nhận
ˈtake to
1. to find acceptable or pleasing. I soon took to her children/idea. yêu, thích
2. to begin to do (something) regularly. He took to smoking a pipe. bắt đầu
take up
1. to use or occupy (space, time etc). I won't take up much of your time. mất nhiều thời gian
2. to begin doing, playing etcHe has taken up the violin/teaching. bắt đầu
3. to shorten (clothes). My skirts were too long, so I had them taken up. làm cho ngắn lại
4. to lift or raise; to pick up. He took up the book. nhặt lên
take (something) upon oneself
to take responsibility for. I took it upon myself to make sure she arrived safely. có trách nhiệm
take (something) up with (someone)
to discuss (especially a complaint). Take the matter up with your MP. thảo luận
JungHyunRan09/04/2014 14:48:49
(1)|
take
Từ điển Anh - Anh
take
verb
1. gripgrabseizecatchgraspclutchget hold ofclasptake hold of, lay hold of He took her by the shoulders and shook her.
2. carrybringbeartransportferryhaulconveyfetchcarttote (informal) I'll take these papers home and read them.
carry send
3. accompanyleadbringguideconductescortconvoyusher She was taken to hospital.
4. removedrawpullfishwithdrawextractabstract He took a handkerchief from his pocket.
5. stealnick (slang, chiefly Brit.)appropriatepockettrouser (slang)pinch (informal)carry offswipe (slang)knock off (slang),run off withblag (slang)walk off withmisappropriatecart off (slang)purloinfilch, help yourself to, gain possession of The burglars took just about anything they could carry.
steal givereturnrestoreyieldhand oversurrendergive back
6. capturearrestseizeabduct, take into custody, ensnareentrap, lay hold of Marines went in and took 15 prisoners.
capture freereleaselet go
7. toleratestandbearsufferweathergo throughbravestomachendureundergoswallowbrookhack (slang)abideput up with (informal)withstand, submit to, countenancepocketthole (Scot.) His rudeness was becoming hard to take.
tolerate avoiddodge
8. last, go on for, continue for, carry on for, endure for, run on for, keep on for The journey took a long time.
9. requireneedinvolvedemandcall forentailnecessitate Walking across the room took all her strength.
10. acceptassumetake onundertakeadopttake upenter upon When I took the job, I thought I could change the system.
accept refusedeclinerejectignoredismissscornspurneschew
11. drawderivefeelknowexperienceundergo The government will take comfort from the latest opinion poll.
12. earnmakenetcollectrealizebring ingross The firm took £100,000 in bookings.
13. winget, be awarded, receiveland (informal)be givenpick upbag (informal)securecollectobtainscoop (informal), be presented with, carry offwalk away or off with He took the gold medal in the 100 metres.
14. receivegetacceptbe givengainobtain She was reluctant to take all the credit.
15. respond to, meetdeal withreceivecope withgreet, react to He had taken the news badly.
16. considerstudythink aboutexaminecontemplateponderweigh upmull overchew over, ruminate on, give thought to, deliberate over, cogitate on Taken in isolation, these statements can be dangerous.
17. understandfollowcomprehendgetseegraspapprehend They've turned sensible, if you take my meaning.
18. regard as, see as, believe to be, consider to be, think of as, deem to be, perceive to be, hold to be, judge to be, reckon to be, presume to be, look on as Do you take me for an idiot?
19. havechoosepickpreferselect, opt for, settle on I'll take the grilled tuna sandwich, please.
20. travelgojourneywalkprogressproceedtrekvoyagetraverse, make your way He had to take a different route home.
21. hirebookrentleasereservepay forengage, make a reservation for My wife and I have taken the cottage for a month.
22. subscribe tobuy, read regularly, purchase, buy regularly Before the Chronicle I used to take the Guardian.
23. travel by, travel on, make use of, journey on We'll take a train home.
24. studylearn, be taught, do (informal)read (Brit.)pursuework atread up on, have lessons in Students may take European and American history.
25. performhavedomakeeffectaccomplishexecute She took her driving test last week.
26. ingestconsumeswallowinhale She's been taking sleeping pills.
27. consumehavedrinkeatimbibe She took tea with Nanny every day.
28. writerecordjot (down)note (down)scribbleset downscrawlmake a note of She sat expressionless, carefully taking notes.
29. measureestablishdeterminefind outassesscalculateevaluategaugeascertainappraise If he feels hotter than normal, take his temperature.
30. have room for, holdcontainaccommodateaccept The place could just about take 2000 people.
31. wearneedrequirefit Half of all women take a size 16 or above.
32. worksucceed, do the trick (informal), have effect, be efficacious If the cortisone doesn't take, I may have to have surgery.
work failflop (informal)
33. extractquoteciteexcerptreproduceabstractcull a passage taken from a talk she gave in 1988
34. occupyuseengageholdfillreservebag (informal) Ninety-five per cent of business-class seats were taken.
35. derivegetobtainacquirecome by Do you know where cappuccino coffee takes its name from?
36. take advantage ofgrabseize (on)exploitgraspact onmake the most ofjump on, pounce on, capitalize onleap atturn to account, put to advantage He took the opportunity to show off his new car.
noun
1. takingsprofitsrevenuereturngateyieldproceedshaulreceipts It added another $11.8 million to the take.
2. scenesequence, filmed sequence She didn't know her lines and we had to do several takes.
3. viewopinion, understanding of, analysis of, interpretation of, reading of, explanation of That sort of thing gives you a different take on who you are.
take after someone resemblebe like, be similar to, look likefavour (informal), remind you of, be the spitting image of (informal), bear a resemblance to, put you in mind of He's always been like that - he takes after his dad.
take against something or someone take a dislike to, feel hostile to, view with disfavour, look askance on, become unfriendly towards He's taken against me for some reason.
take it assumesupposepresumeexpectimagineguess (informal, chiefly U.S. & Canad.) I take it you're a friend of theirs.
take it out of someone exhausttiredrainfatiguewearybush (informal)whack (informal)wear outdebilitateknacker (informal),enervate That last race really took it out of me.
take off
1. lift off, leave the ground, take to the air, become airborne We eventually took off at 11am and arrived in Venice at 1.30pm.
2. (Informal) departgoleavesplit (slang)disappearset outstrike outbeat it (slang)hit the road (slang)absconddecamp, hook it (slang)slope off, pack your bags (informal) He took off at once and headed home.
3. do wellsucceedthriveflourishprogressboomprosper, have legs (informal), turn out well He met her in 1944, and his career took off.
take on (Informal) get upset, get excited, make a fussbreak downgive way Please don't take on so. I'll help you.
take someone back
1. be reconciled with, forgivepardon, welcome someone back, accept someone back Why did she take him back?
2. evoke, remind you of, awaken your memories of, call upsummon up It took me back to my childhood.
take someone in
1. let inreceiveadmitboardwelcomeharbouraccommodatetake care ofput upbillet The monastery has taken in 26 refugees.
2. deceivefoolcon (informal)do (slang)trickcheatmisleaddupegull (archaic)swindlehoodwinkpull the wool over someone's eyes (informal)bilkcozen He was a real charmer who totally took me in.
take someone off (Informal) parodyimitatemimicmockridiculeapecaricaturesend up (Brit. informal)spoof (informal)travesty,impersonatelampoonburlesquesatirize He can take off his father to perfection.
take someone on
1. compete against, face, contend with, fightoppose, vie with, pit yourself against, enter the lists against, match yourself against I knew I couldn't take him on if it came to a fight.
2. engageemployhireretainenlistenrol A publishing firm agreed to take him on.
take someone out
1. escortaccompany, go out with Her grandparents took her out for the day.
2. (Informal) killmurderexecuteassassinatetop (informal)eliminate, do someone in (informal)get rid ofdispatch, put an end to, do away withexterminate, finish someone off, put someone to death, bump someone off (informal), rub someone out(informal) The local dealers would have taken him out years ago.
take something apart
1. dismantlebreak uppull apartdisassemblepull or take to pieces or bits He took the clock apart to find out what was wrong with it.
2. dissectstudyanalysescrutinizeresearchexplorebreak down They took the problem apart and discussed it in detail.
take something away subtractdeduct, take something off Take one number away from the other and you get the answer.
take something back
1. return, bring something back, send something back, hand something back I'm going to take it back and ask for a refund.
2. give a refund for, exchange, accept something back The store wouldn't take damaged goods back.
3. retractwithdrawrenouncerenege ondisavowrecantdisclaimunsay Take back what you said about Jeremy!
4. regainget backreclaimrecapturerepossessretakereconquer The government took back control of the city.
take something down
1. removetake offextract He went to the bookcase and took down a volume.
2. lowerdroplet downpull downhaul down The flag was taken down from the flag pole.
3. dismantledemolishtake apartdisassembleleveltear downraze, take to pieces They took down the barricades that had been erected.
4. make a note ofrecordwrite downminutenoteset downtranscribe, put on record I took down his comments in shorthand.
take something in
1. understandabsorbgraspdigestcomprehendassimilate, get the hang of (informal) She seemed to take in all he said.
2. includecontaincomprisecoverembraceencompass The country takes in a population of more than 40 million people.
take something off
1. removediscardstrip offdroppeel offdoff, divest yourself of She took off her spectacles.
2. detachremoveseparatecut offpull offchop offhack offclip off, prune off Take off the first few layers of wallpaper.
3. subtractdeduct, take something away, removeeliminate Take off the price of the house; that's another five thousand.
take something on
1. accepttackleundertakeshoulder, have a go at (informal), agree to do, address yourself to No one was able or willing to take on the job.
2. (with a quality or identity as object) acquireassume, come to have His writing took on a feverish intensity.
take something or someone apart attackpan (informal)condemnslam (informal)savagecensuremaulpilloryflaydiss (slang, chiefly U.S.)flame (informal)lambaste, criticize harshly The critics had taken her apart.
take something out extractremovepull outdrawyank out I got an abscess so he took the tooth out.
take something over gain control of, take command of, assume control of, come to power in, become leader of They took over Rwanda under a League of Nations mandate.
take something up
1. startbegin, engage in, assumeadopt, become involved in He didn't want to take up a competitive sport.
2. acceptagree to, say yes to, accede to Most of the employees took up the offer.
3. occupyabsorbconsumeuse upcoverfillwastesquander, extend over I don't want to take up too much of your time.
4. resumecontinue, go on with, pick up, proceed with, restart, carry on with, recommence, follow on with, begin something again His wife takes up the story.
take to someone likeget on withwarm to, be taken with, be pleased by, become friendly with, conceive an affection for Did the children take to him?
take to something
1. startresort to, make a habit of, have recourse to They had taken to aimlessly wandering through the streets.
2. become good at, likeenjoy, become interested in, develop an aptitude for She took to the piano immediately.
3. head formake forrun for, flee to He took to the roof of his home when police officers came round.
take up with someone become friendly with, get involved with, start seeing, fall in with, go around with, become friends with, hang about with (Brit. informal)knock about or around with (informal) He took up with a woman 21 years his junior.
take yourself off go awaywithdrawdepartretireexitclear out (informal)clear off (informal)bog off (Brit. slang), take your leave He took himself off to Mexico.
JungHyunRan09/04/2014 14:47:48
(1)|
take
Từ điển Anh - Anh
Noun1.take - the income or profit arising from such transactions as the sale of land or other property; "the average return was about 5%"
income - the financial gain (earned or unearned) accruing over a given period of time
economic rentrent - the return derived from cultivated land in excess of that derived from the poorest land cultivated under similar conditions
payback - financial return or reward (especially returns equal to the initial investment)
2.take - the act of photographing a scene or part of a scene without interruption
cinematographyfilmingmotion-picture photography - the act of making a film
retake - a shot or scene that is photographed again
Verb1.take - carry out; "take action"; "take steps"; "take vengeance"
actmove - perform an action, or work out or perform (an action); "think before you act"; "We must move quickly"; "The governor should act on the new energy bill"; "The nanny acted quickly by grabbing the toddler and covering him with a wet towel"
2.take - require (time or space); "It took three hours to get to work this morning"; "This event occupied a very short time"
depleteuse upwipe outeat upexhaustrun througheatconsume - use up (resources or materials); "this car consumes a lot of gas"; "We exhausted our savings"; "They run through 20 bottles of wine a week"
expenduse - use up, consume fully; "The legislature expended its time on school questions"
be - spend or use time; "I may be an hour"
3.take - take somebody somewhere; "We lead him to our chief"; "can you take me to the main entrance?"; "He conducted us to the palace"
beacon - guide with a beacon
hand - guide or conduct or usher somewhere; "hand the elderly lady into the taxi"
misguidemisleadlead astraymisdirect - lead someone in the wrong direction or give someone wrong directions; "The pedestrian misdirected the out-of-town driver"
ushershow - take (someone) to their seats, as in theaters or auditoriums; "The usher showed us to our seats"
4.take - get into one's hands, take physically; "Take a cookie!"; "Can you take this bag, please"
clutchprehendseize - take hold of; grab; "The sales clerk quickly seized the money on the counter"; "She clutched her purse"; "The mother seized her child by the arm"; "Birds of prey often seize small mammals"
seize - take or capture by force; "The terrorists seized the politicians"; "The rebels threaten to seize civilian hostages"
gather intake in - fold up; "take in the sails"
lift outscoopscoop upscoop outtake up - take out or up with or as if with a scoop; "scoop the sugar out of the container"
bear awaybear offcarry awaytake awaycarry off - remove from a certain place, environment, or mental or emotional state; transport into a new location or state; "Their dreams carried the Romantics away into distant lands"; "The car carried us off to the meeting"; "I'll take you away on a holiday"; "I got carried away when I saw the dead man and I started to cry"
discerpdismembertake apart - divide into pieces; "our department was dismembered when our funding dried up"; "The Empire was discerped after the war"
take in - visit for entertainment; "take in the sights"
tackleundertaketake on - accept as a challenge; "I'll tackle this difficult task"
5.take - take on a certain form, attribute, or aspecttake - take on a certain form, attribute, or aspect; "His voice took on a sad tone"; "The story took a new turn"; "he adopted an air of superiority"; "She assumed strange manners"; "The gods assume human or animal form in these fables"
change - undergo a change; become different in essence; losing one's or its original nature; "She changed completely as she grew older"; "The weather changed last night"
re-assume - take on again, as after a time lapse; "He re-assumed his old behavior"
6.take - interpret something in a certain way; convey a particular meaning or impression; "I read this address as a satire"; "How should I take this message?"; "You can't take credit for this!"
read - to hear and understand; "I read you loud and clear!"
construeinterpretsee - make sense of; assign a meaning to; "What message do you see in this letter?"; "How do you interpret his behavior?"
misinterpretmisread - interpret wrongly; "I misread Hamlet all my life!"
read - interpret the significance of, as of palms, tea leaves, intestines, the sky; also of human behavior; "She read the sky and predicted rain"; "I can't read his strange behavior"; "The fortune teller read his fate in the crystal ball"
7.take - take something or somebody with oneself somewhere; "Bring me the box from the other room"; "Take these letters to the boss"; "This brings me to the main point"
fetchbringgetconvey - go or come after and bring or take back; "Get me those books over there, please"; "Could you bring the wine?"; "The dog fetched the hat"
fetch - take away or remove; "The devil will fetch you!"
bring - be accompanied by; "Can I bring my cousin to the dinner?"
carrytransport - move while supporting, either in a vehicle or in one's hands or on one's body; "You must carry your camping gear"; "carry the suitcases to the car"; "This train is carrying nuclear waste"; "These pipes carry waste water into the river"
transit - cause or enable to pass through; "The canal will transit hundreds of ships every day"
ferry - transport from one place to another
bring backtake backreturn - bring back to the point of departure
tube - convey in a tube; "inside Paris, they used to tube mail"
whisk - move somewhere quickly; "The President was whisked away in his limo"
channeltransmitcarryimpartconductconvey - transmit or serve as the medium for transmission; "Sound carries well over water"; "The airwaves carry the sound"; "Many metals conduct heat"
land - bring ashore; "The drug smugglers landed the heroin on the beach of the island"
8.take - take into one's possession; "We are taking an orphan from Romania"; "I'll take three salmon steaks"
adopttake in - take into one's family; "They adopted two children from Nicaragua"
take away - take from a person or place; "We took the abused child away from its parents"
repossesstake back - regain possession of something
collecttake in - call for and obtain payment of; "we collected over a million dollars in outstanding debts"; "he collected the rent"
confiscateimpoundsequesterseizeattach - take temporary possession of as a security, by legal authority; "The FBI seized the drugs"; "The customs agents impounded the illegal shipment"; "The police confiscated the stolen artwork"
sequester - requisition forcibly, as of enemy property; "the estate was sequestered"
pocket - put in one's pocket; "He pocketed the change"
assumetake overacceptbear - take on as one's own the expenses or debts of another person; "I'll accept the charges"; "She agreed to bear the responsibility"
snafflesnap upgrab - get hold of or seize quickly and easily; "I snapped up all the good buys during the garage sale"
call backwithdrawcall inrecall - cause to be returned; "recall the defective auto tires"; "The manufacturer tried to call back the spoilt yoghurt"
deprivediveststrip - take away possessions from someone; "The Nazis stripped the Jews of all their assets"
unburden - free or relieve (someone) of a burden
repossesstake back - regain possession of something
draw offtake outwithdrawdraw - remove (a commodity) from (a supply source); "She drew $2,000 from the account"; "The doctors drew medical supplies from the hospital's emergency bank"
take in - visit for entertainment; "take in the sights"
give - transfer possession of something concrete or abstract to somebody; "I gave her my money"; "can you give me lessons?"; "She gave the children lots of love and tender loving care"
9.take - travel or go by means of a certain kind of transportation, or a certain route; "He takes the bus to work"; "She takes Route 1 to Newark"
applyemployuseutiliseutilize - put into service; make work or employ for a particular purpose or for its inherent or natural purpose; "use your head!"; "we only use Spanish at home"; "I can't use this tool"; "Apply a magnetic field here"; "This thinking was applied to many projects"; "How do you utilize this tool?"; "I apply this rule to get good results"; "use the plastic bags to store the food"; "He doesn't know how to use a computer"
10.take - pick out, select, or choose from a number of alternatives; "Take any one of these cards"; "Choose a good husband for your daughter"; "She selected a pair of shoes from among the dozen the salesgirl had shown her"
empanelimpanelpanel - select from a list; "empanel prospective jurors"
anoint - choose by or as if by divine intervention; "She was anointed the head of the Christian fundamentalist group"
field - select (a team or individual player) for a game; "The Buckeyes fielded a young new quarterback for the Rose Bowl"
sievesift - distinguish and separate out; "sift through the job candidates"
draw - select or take in from a given group or region; "The participants in the experiment were drawn from a representative population"
dial - choose by means of a dial; "dial a telephone number"
plumpgo - give support (to) or make a choice (of) one out of a group or number; "I plumped for the losing candidates"
pick - select carefully from a group; "She finally picked her successor"; "He picked his way carefully"
elect - choose; "I elected to have my funds deposited automatically"
excerptextracttake out - take out of a literary work in order to cite or copy
cull outwinnow - select desirable parts from a group or list; "cull out the interesting letters from the poet's correspondence"; "winnow the finalists from the long list of applicants"
cream offskim off - pick the best
pick oversieve out - separate or remove; "The customer picked over the selection"
set apartassignspecify - select something or someone for a specific purpose; "The teacher assigned him to lead his classmates in the exercise"
single out - select from a group; "She was singled out for her outstanding performance"
decidemake up one's minddetermine - reach, make, or come to a decision about something; "We finally decided after lengthy deliberations"
think of - choose in one's mind; "Think of any integer between 1 and 25"
specifyfixlimitsetdeterminedefine - decide upon or fix definitely; "fix the variables"; "specify the parameters"
adoptespousefollow - choose and follow; as of theories, ideas, policies, strategies or plans; "She followed the feminist movement"; "The candidate espouses Republican ideals"
screen outsievesortscreen - examine in order to test suitability; "screen these samples"; "screen the job applicants"
vote in - elect in a voting process; "They voted in Clinton"
elect - select by a vote for an office or membership; "We elected him chairman of the board"
nominatepropose - put forward; nominate for appointment to an office or for an honor or position; "The President nominated her as head of the Civil Rights Commission"
vote - express one's preference for a candidate or for a measure or resolution; cast a vote; "He voted for the motion"; "None of the Democrats voted last night"
11.take - receive willingly something given or offeredtake - receive willingly something given or offered; "The only girl who would have him was the miller's daughter"; "I won't have this dog in my house!"; "Please accept my present"
receivehave - get something; come into possession of; "receive payment"; "receive a gift"; "receive letters from the front"
acquireget - come into the possession of something concrete or abstract; "She got a lot of paintings from her uncle"; "They acquired a new pet"; "Get your results the next day"; "Get permission to take a few days off from work"
admittake onaccepttake - admit into a group or community; "accept students for graduate study"; "We'll have to vote on whether or not to admit a new member"
welcome - accept gladly; "I welcome your proposals"
honorhonour - accept as pay; "we honor checks and drafts"
adoptborrowtake uptake over - take up and practice as one's own
absorbtake over - take up, as of debts or payments; "absorb the costs for something"
assumetake overacceptbear - take on as one's own the expenses or debts of another person; "I'll accept the charges"; "She agreed to bear the responsibility"
adoptborrowtake uptake over - take up and practice as one's own
take in - provide with shelter
12.take - assume, as of positions or roles; "She took the job as director of development"; "he occupies the position of manager"; "the young prince will soon occupy the throne"
assumetake upstriketake - occupy or take on; "He assumes the lotus position"; "She took her seat on the stage"; "We took our seats in the orchestra"; "She took up her position behind the tree"; "strike a pose"
do workwork - be employed; "Is your husband working again?"; "My wife never worked"; "Do you want to work after the age of 60?"; "She never did any work because she inherited a lot of money"; "She works as a waitress to put herself through college"
13.take - take into consideration for exemplifying purposes; "Take the case of China"; "Consider the following case"
contemplate - consider as a possibility; "I contemplated leaving school and taking a full-time job"
trifledallyplay - consider not very seriously; "He is trifling with her"; "She plays with the thought of moving to Tasmania"
think about - have on one's mind, think about actively; "I'm thinking about my friends abroad"; "She always thinks about her children first"
abstract - consider apart from a particular case or instance; "Let's abstract away from this particular example"
warm to - become excited about; "He warmed to the idea of a trip to Antarctica"
14.take - require as useful, just, or proper; "It takes nerve to do what she did"; "success usually requires hard work"; "This job asks a lot of patience and skill"; "This position demands a lot of personal sacrifice"; "This dinner calls for a spectacular dessert"; "This intervention does not postulate a patient's consent"
exactclaimtake - take as an undesirable consequence of some event or state of affairs; "the accident claimed three lives"; "The hard work took its toll on her"
govern - require to be in a certain grammatical case, voice, or mood; "most transitive verbs govern the accusative case in German"
draw - require a specified depth for floating; "This boat draws 70 inches"
cost - require to lose, suffer, or sacrifice; "This mistake cost him his job"
cry forcry out for - need badly or desperately; "This question cries out for an answer"
compel - necessitate or exact; "the water shortage compels conservation"
15.take - experience or feel or submit to; "Take a test"; "Take the plunge"
submittake - accept or undergo, often unwillingly; "We took a pay cut"
experiencehavereceiveget - go through (mental or physical states or experiences); "get an idea"; "experience vertigo"; "get nauseous"; "receive injuries"; "have a feeling"
16.take - make a film or photograph of something; "take a scene"; "shoot a movie"
motion picturemotion-picture showmoviemoving picturemoving-picture showpicfilmpicture showflickpicture - a form of entertainment that enacts a story by sound and a sequence of images giving the illusion of continuous movement; "they went to a movie every Saturday night"; "the film was shot on location"
recordenterput down - make a record of; set down in permanent form
photographshootsnap - record on photographic film; "I photographed the scene of the accident"; "She snapped a picture of the President"
reshoot - shoot again; "We had to reshoot that scene 24 times"
17.take - remove something concrete, as by lifting, pushing, or taking off, or remove something abstract; "remove a threat"; "remove a wrapper"; "Remove the dirty dishes from the table"; "take the gun from your pocket"; "This machine withdraws heat from the environment"
depilateepilate - remove body hair; "epilate her legs"
harvest - remove from a culture or a living or dead body, as for the purposes of transplantation; "The Chinese are said to harvest organs from executed criminals"
tip - remove the tip from; "tip artichokes"
stem - remove the stem from; "for automatic natural language processing, the words must be stemmed"
extirpate - surgically remove (an organ)
enucleate - remove (a tumor or eye) from an enveloping sac or cover
exenterate - remove the contents of (an organ)
enucleate - remove the nucleus from (a cell)
decorticate - remove the cortex of (an organ)
bail - remove (water) from a vessel with a container
undressdisinvestdiveststrip - remove (someone's or one's own) clothes; "The nurse quickly undressed the accident victim"; "She divested herself of her outdoor clothes"; "He disinvested himself of his garments"
ablate - remove an organ or bodily structure
cleanpick - remove unwanted substances from, such as feathers or pits; "Clean the turkey"
clean - remove shells or husks from; "clean grain before milling it"
winnow - blow away or off with a current of air; "winnow chaff"
pick - remove in small bits; "pick meat from a bone"
clear upclear - free (the throat) by making a rasping sound; "Clear the throat"
muck - remove muck, clear away muck, as in a mine
lift - remove from a surface; "the detective carefully lifted some fingerprints from the table"
lift - take off or away by decreasing; "lift the pressure"
lift - remove from a seedbed or from a nursery; "lift the tulip bulbs"
tear awaytear off - rip off violently and forcefully; "The passing bus tore off her side mirror"
take off - take away or remove; "Take that weight off me!"
take awaytake out - take out or remove; "take out the chicken after adding the vegetables"
stonepit - remove the pits from; "pit plums and cherries"
seed - remove the seeds from; "seed grapes"
unhinge - remove the hinges from; "unhinge the door"
shuck - remove the shucks from; "shuck corn"
hull - remove the hulls from; "hull the berries"
crumb - remove crumbs from; "crumb the table"
chip awaychip away at - remove or withdraw gradually: "These new customs are chipping away at the quality of life"
burl - remove the burls from cloth
knock out - destroy or break forcefully; "The windows were knocked out"
scavengeclean - remove unwanted substances from
hypophysectomisehypophysectomize - remove the pituitary glands
degas - remove gas from
huskshell - remove the husks from; "husk corn"
burburr - remove the burrs from
clear awayclear off - remove from sight
flick - remove with a flick (of the hand)
dismantlestrip - take off or remove; "strip a wall of its wallpaper"
strip - remove a constituent from a liquid
clear - remove; "clear the leaves from the lawn"; "Clear snow from the road"
defang - remove the fangs from; "defang the poisonous snake"
debonebone - remove the bones from; "bone the turkey before roasting it"
disembowelevisceratedraw - remove the entrails of; "draw a chicken"
shell - remove from its shell or outer covering; "shell the legumes"; "shell mussels"
shuck - remove from the shell; "shuck oysters"
detusktusk - remove the tusks of animals; "tusk an elephant"
dehorn - prevent the growth of horns of certain animals
scalp - remove the scalp of; "The enemies were scalped"
weed - clear of weeds; "weed the garden"
18.take - serve oneself to, or consume regularly; "Have another bowl of chicken soup!"; "I don't take sugar in my coffee"
hit - consume to excess; "hit the bottle"
cannibalisecannibalize - eat human flesh
habituateuse - take or consume (regularly or habitually); "She uses drugs rarely"
eat - eat a meal; take a meal; "We did not eat until 10 P.M. because there were so many phone calls"; "I didn't eat yet, so I gladly accept your invitation"
eat - take in solid food; "She was eating a banana"; "What did you eat for dinner last night?"
drinkimbibe - take in liquids; "The patient must drink several liters each day"; "The children like to drink soda"
boozedrinkfuddle - consume alcohol; "We were up drinking all night"
partaketouch - consume; "She didn't touch her food all night"
eatfeed - take in food; used of animals only; "This dog doesn't eat certain kinds of meat"; "What do whales eat?"
repletesatesatiatefill - fill to satisfaction; "I am sated"
sampletastetrytry out - take a sample of; "Try these new crackers"; "Sample the regional dishes"
suck insop uptake uptake in - take up as if with a sponge
smoke - inhale and exhale smoke from cigarettes, cigars, pipes; "We never smoked marijuana"; "Do you smoke?"
do drugsdrug - use recreational drugs
swallowget down - pass through the esophagus as part of eating or drinking; "Swallow the raw fish--it won't kill you!"
sup - take solid or liquid food into the mouth a little at a time either by drinking or by eating with a spoon
suck insop uptake uptake in - take up as if with a sponge
19.take - accept or undergo, often unwillinglytake - accept or undergo, often unwillingly; "We took a pay cut"
test - undergo a test; "She doesn't test well"
undergo - pass through; "The chemical undergoes a sudden change"; "The fluid undergoes shear"; "undergo a strange sensation"
take - experience or feel or submit to; "Take a test"; "Take the plunge"
20.take - make use of or accept for some purposetake - make use of or accept for some purpose; "take a risk"; "take an opportunity"
co-opt - take or assume for one's own use; "He co-opted the criticism and embraced it"
21.take - take by force; "Hitler took the Baltic Republics"; "The army took the fort on the hill"
rescue - take forcibly from legal custody; "rescue prisoners"
scale - take by attacking with scaling ladders; "The troops scaled the walls of the fort"
extort - obtain through intimidation
take overusurparrogateseizeassume - seize and take control without authority and possibly with force; take as one's right or possession; "He assumed to himself the right to fill all positions in the town"; "he usurped my rights"; "She seized control of the throne after her husband died"
retakerecapture - take back by force, as after a battle; "The military forces managed to recapture the fort"
relieve - take by stealing; "The thief relieved me of $100"
steal - take without the owner's consent; "Someone stole my wallet on the train"; "This author stole entire paragraphs from my dissertation"
despoilforaypillageransackreaveriflelootplunderstrip - steal goods; take as spoils; "During the earthquake people looted the stores that were deserted by their owners"
sackplunder - plunder (a town) after capture; "the barbarians sacked Rome"
22.take - occupy or take ontake - occupy or take on; "He assumes the lotus position"; "She took her seat on the stage"; "We took our seats in the orchestra"; "She took up her position behind the tree"; "strike a pose"
move - move so as to change position, perform a nontranslational motion; "He moved his hand slightly to the right"
filloccupytake - assume, as of positions or roles; "She took the job as director of development"; "he occupies the position of manager"; "the young prince will soon occupy the throne"
23.take - admit into a group or communitytake - admit into a group or community; "accept students for graduate study"; "We'll have to vote on whether or not to admit a new member"
profess - receive into a religious order or congregation
accepttakehave - receive willingly something given or offered; "The only girl who would have him was the miller's daughter"; "I won't have this dog in my house!"; "Please accept my present"
let inadmitinclude - allow participation in or the right to be part of; permit to exercise the rights, functions, and responsibilities of; "admit someone to the profession"; "She was admitted to the New Jersey Bar"
24.take - ascertain or determine by measuring, computing or take a reading from a dial; "take a pulse"; "A reading was taken of the earth's tremors"
incurobtainreceivegetfind - receive a specified treatment (abstract); "These aspects of civilization do not find expression or receive an interpretation"; "His movie received a good review"; "I got nothing but trouble for my good intentions"
25.take - be a student of a certain subject; "She is reading for the bar exam"
audit - attend academic courses without getting credit
trainprepare - undergo training or instruction in preparation for a particular role, function, or profession; "She is training to be a teacher"; "He trained as a legal aid"
practicepractisedrillexercise - learn by repetition; "We drilled French verbs every day"; "Pianists practice scales"
26.take - take as an undesirable consequence of some event or state of affairs; "the accident claimed three lives"; "The hard work took its toll on her"
necessitateneedrequirecall fordemandpostulateinvolveasktake - require as useful, just, or proper; "It takes nerve to do what she did"; "success usually requires hard work"; "This job asks a lot of patience and skill"; "This position demands a lot of personal sacrifice"; "This dinner calls for a spectacular dessert"; "This intervention does not postulate a patient's consent"
27.take - head into a specified direction; "The escaped convict took to the hills"; "We made for the mountains"
head - to go or travel towards; "where is she heading"; "We were headed for the mountains"
28.take - point or cause to go (blows, weapons, or objects such as photographic equipment) towardstake - point or cause to go (blows, weapons, or objects such as photographic equipment) towards; "Please don't aim at your little brother!"; "He trained his gun on the burglar"; "Don't train your camera on the women"; "Take a swipe at one's opponent"
targetdirectaimplacepoint - intend (something) to move towards a certain goal; "He aimed his fists towards his opponent's face"; "criticism directed at her superior"; "direct your anger towards others, not towards yourself"
draw a bead on - aim with a gun; "The hunter drew a bead on the rabbit"
hold - aim, point, or direct; "Hold the fire extinguisher directly on the flames"
turn - direct at someone; "She turned a smile on me"; "They turned their flashlights on the car"
swing - hit or aim at with a sweeping arm movement; "The soccer player began to swing at the referee"
pointlevelcharge - direct into a position for use; "point a gun"; "He charged his weapon at me"
level - aim at; "level criticism or charges at somebody"
position - cause to be in an appropriate place, state, or relation
sight - take aim by looking through the sights of a gun (or other device)
29.take - be seized or affected in a specified way; "take sick"; "be taken drunk"
becomegetgo - enter or assume a certain state or condition; "He became annoyed when he heard the bad news"; "It must be getting more serious"; "her face went red with anger"; "She went into ecstasy"; "Get going!"
30.take - have with oneself; have on one's person; "She always takes an umbrella"; "I always carry money"; "She packs a gun when she goes into the mountains"
featurehave - have as a feature; "This restaurant features the most famous chefs in France"
carry - have or possess something abstract; "I carry her image in my mind's eye"; "I will carry the secret to my grave"; "I carry these thoughts in the back of my head"; "I carry a lot of life insurance"
31.take - engage for service under a term of contract; "We took an apartment on a quiet street"; "Let's rent a car"; "Shall we take a guide in Rome?"
acquireget - come into the possession of something concrete or abstract; "She got a lot of paintings from her uncle"; "They acquired a new pet"; "Get your results the next day"; "Get permission to take a few days off from work"
32.take - receive or obtain regularly; "We take the Times every day"
buypurchase - obtain by purchase; acquire by means of a financial transaction; "The family purchased a new car"; "The conglomerate acquired a new company"; "She buys for the big department store"
33.take - buy, select; "I'll take a pound of that sausage"
commercecommercialismmercantilism - transactions (sales and purchases) having the objective of supplying commodities (goods and services)
buypurchase - obtain by purchase; acquire by means of a financial transaction; "The family purchased a new car"; "The conglomerate acquired a new company"; "She buys for the big department store"
draw offtake outwithdrawdraw - remove (a commodity) from (a supply source); "She drew $2,000 from the account"; "The doctors drew medical supplies from the hospital's emergency bank"
34.take - to get into a position of having, e.g., safety, comfort; "take shelter from the storm"
35.take - have sex with; archaic use; "He had taken this woman when she was most vulnerable"
bonkdo itefffuckget it onget laidhave a go at ithave intercoursehave it awayhave it offhave sexbe intimatelie withroll in the hayscrewsleep togethersleep withmake lovehumpjazzlovebedbangmake outknow - have sexual intercourse with; "This student sleeps with everyone in her dorm"; "Adam knew Eve"; "Were you ever intimate with this man?"
36.take - lay claim to; as of an idea; "She took credit for the whole idea"
avowswanswearaffirmassertaververify - to declare or affirm solemnly and formally as true; "Before God I swear I am innocent"
arrogatelay claimclaim - demand as being one's due or property; assert one's right or title to; "He claimed his suitcases at the airline counter"; "Mr. Smith claims special tax exemptions because he is a foreign resident"
37.take - be designed to hold or taketake - be designed to hold or take; "This surface will not take the dye"
be - have the quality of being; (copula, used with an adjective or a predicate noun); "John is rich"; "This is not a good answer"
38.take - be capable of holding or containing; "This box won't take all the items"; "The flask holds one gallon"
be - have the quality of being; (copula, used with an adjective or a predicate noun); "John is rich"; "This is not a good answer"
containbearcarryhold - contain or hold; have within; "The jar carries wine"; "The canteen holds fresh water"; "This can contains water"
accommodateadmithold - have room for; hold without crowding; "This hotel can accommodate 250 guests"; "The theater admits 300 people"; "The auditorium can't hold more than 500 people"
39.take - develop a habit; "He took to visiting bars"
40.take - proceed along in a vehicle; "We drive the turnpike to work"
driving - the act of controlling and steering the movement of a vehicle or animal
crosscut acrosscut throughget overtraversepass overget acrosstrackcover - travel across or pass over; "The caravan covered almost 100 miles each day"
motordrive - travel or be transported in a vehicle; "We drove to the university every morning"; "They motored to London for the theater"
drive - operate or control a vehicle; "drive a car or bus"; "Can you drive this four-wheel truck?"
drive - cause someone or something to move by driving; "She drove me to school every day"; "We drove the car to the garage"
41.take - obtain by winning; "Winner takes all"; "He took first prize"
win - be the winner in a contest or competition; be victorious; "He won the Gold Medal in skating"; "Our home team won"; "Win the game"
42.take - be stricken by an illness, fall victim to an illness; "He got AIDS"; "She came down with pneumonia"; "She took a chill"
sickencome down - get sick; "She fell sick last Friday, and now she is in the hospital"
catch - contract; "did you catch a cold?"
JungHyunRan09/04/2014 14:46:37
(1)|
take
Từ điển Anh - Anh
take  (tāk)
v. took (toÂok)tak·en (tā′kən)tak·ingtakes
v.tr.
1. To get into one's possession by force, skill, or artifice, especially:
a. To capture physically; seize: take an enemy fortress.
b. To seize with authority; confiscate.
c. To kill, snare, or trap (fish or game, for example).
d. Sports & Games To acquire in a game or competition; win: took the crown in horseracing.
e. Sports & Games To defeat: Our team took the visitors three to one.
f. Sports To catch (a ball in play), especially in baseball: The player took it on the fly.
2. To grasp with the hands; grip: Take your partner's hand.
3. To encounter or catch in a particular situation; come upon; discover: Your actions took me by surprise.
4. To deal a blow to; strike or hit: The boxer took his opponent a sharp jab to the ribs.
5. To affect favorably or winsomely; charm or captivate: She was taken by the puppy.
6.
a. To put (food or drink, for example) into the body; eat or drink: took a little soup for dinner.
b. To draw in; inhale: took a deep breath.
7. To expose one's body to (healthful or pleasurable treatment, for example): take the sun; take the waters at a spa.
8. To bring or receive into a particular relation, association, or other connection: take a new partner into the firm; take a company national.
9. To engage in sex with.
10. To accept and place under one's care or keeping.
11. To appropriate for one's own or another's use or benefit; obtain by purchase; secure or buy: We always take season tickets.
12. To assume for oneself: take all the credit.
a. To charge or oblige oneself with the fulfillment of (a task or duty, for example); commit oneself to: She took the position of chair of the committee.
b. To pledge one's obedience to; impose (a vow or promise) upon oneself.
c. To impose upon oneself; subject oneself to: We took extra time to do the job properly.
d. To accept or adopt for one's own: She took his side in the dispute.
e. To put forth or adopt as a point of argument, defense, or discussion.
f. To require or have as a fitting or proper accompaniment: Transitive verbs take a direct object.
13. To pick out; select or choose: take any card.
a. To choose for one's own use; avail oneself of the use of: We took a rented car.
b. To use (something) as when in operation: This camera takes 35mm film.
c. To use (something) as a means of conveyance or transportation: take a train to Pittsburgh.
d. To use (something) as a means of safety or refuge: take shelter from the storm.
e. To choose and then adopt (a particular route or direction) while on foot or while operating a vehicle: Take a right at the next corner. The driver downshifted to take the corner.
14. To assume occupancy of: take a seat.
15. To require (something) as a basic necessity: It takes money to live in that town.
16. To obtain from a source; derive or draw: The book takes its title from the Bible.
17. To obtain, as through measurement or a specified procedure: took the patient's temperature.
18. To write or make a record of, especially in shorthand or cursive writing: take a letter; take notes.
19. To create (an image, likeness, or representation), as by drawing, painting, or photography: took a picture of us.
20. To include or distribute (a charge) in a financial record.
21.
a. To accept (something owed, offered, or given) either reluctantly or willingly: take a bribe.
b. To submit to (something inflicted); undergo or suffer: didn't take his punishment well.
c. To put up with; endure or tolerate: I've had about all I can take from them.
d. Baseball To refrain from swinging at (a pitched ball).
e. To be affected with; catch: The child took the flu.
f. To be hit or penetrated by: took a lot of punches; took a bullet in the leg.
g. To withstand: The dam took the heavy flood waters.
22.
a. To accept or believe (something put forth) as true: I'll take your word.
b. To follow (advice, a suggestion, or a lead, for example).
c. To accept, handle, or deal with in a particular way: He takes things in stride.
d. To consider in a particular relation or from a particular viewpoint: take the bitter with the sweet.
23. To undertake, make, or perform: take a walk; take a decision.
24.
a. To allow to come in; give access or admission to; admit: The boat took a lot of water but remained afloat.
b. To provide room for; accommodate: We can't take more than 100 guests.
c. To become saturated or impregnated with (dye, for example).
25.
a. To understand or interpret: May I take your smile as an indication of approval?
b. To consider; assume: Take the matter as settled.
c. To consider to be equal to; reckon: We take their number at 1,000.
d. To perceive or feel; experience: She took a dislike to his intrusions.
26. To carry, convey, lead, or cause to go along to another place: Don't forget to take your umbrella. This bus takes you to New York.See Usage Note at bring.
27. To remove from a place: take the dishes from the sink.
28. To secure by removing: The dentist took two molars.
29. To cause to die; kill or destroy: The blight took these tomatoes.
30. To subtract: take 15 from 30.
31. To exact: The storm took its toll.
32.
a. To commit and apply oneself to the study of: take art lessons; take Spanish.
b. To study for with success: took a degree in law.
33. Informal To swindle, defraud, or cheat: You've really been taken.
v.intr.
1. To acquire possession.
2. To engage or mesh; catch, as gears or other mechanical parts.
3. To start growing; root or germinate: Have the seeds taken?
4. To have the intended effect; operate or work: The skin graft took.
5. To gain popularity or favor: The television series, which didn't take, was later canceled.
6. To become: He took sick.
n.
1.
a. The act or process of taking.
b. That which is taken.
2.
a. A quantity collected at one time, especially the amount of profit or receipts taken on a business arrangement or venture.
b. The number of fish, game birds, or other animals killed or captured at one time.
3. Sports The amount of money collected as admission to a sporting event; the gate.
4. The uninterrupted running of a movie or television camera or a set of recording equipment in filming a movie or television program or cutting a record.
5.
a. A scene filmed or televised without interrupting the run of the camera.
b. A recording made in a single session.
6.
a. A physical reaction, such as a rash, indicating a successful vaccination.
b. A successful graft.
7. Slang An attempt or a try: He got the answer on the third take.
8. Informal An interpretation or assessment, as of an event: The mayor was asked for his take on the judge's decision.
Phrasal Verbs:
take after
1. To follow as an example.
2. To resemble in appearance, temperament, or character.
take apart
1. To divide into parts after disassembling.
2. To dissect or analyze (a theory, for example), usually in an effort to discover hidden or innate flaws or weaknesses.
3. Slang To beat up; thrash.
take back
To retract (something stated or written).
take down
1. To bring to a lower position from a higher one.
2. To take apart; dismantle: take down the Christmas tree.
3. To lower the arrogance or the self-esteem of (a person): really took him down during the debate.
4. To put down in writing.
take for
1. To regard as: Do you take me for a fool?
2. To consider mistakenly: Don't take silence for approval.
take in
1. To grant admittance to; receive as a guest or an employee.
2. To reduce in size; make smaller or shorter: took in the waist on the pair of pants.
3. To include or constitute.
4. To understand: couldn't take in the meaning of the word.
5. To deceive or swindle: was taken in by a confidence artist.
6. To look at thoroughly; view: took in the sights.
7. To accept (work) to be done in one's house for pay: took in typing.
8. To convey (a prisoner) to a police station.
take off
1. To remove, as clothing: take one's coat off; take off one's galoshes.
2. To release: took the brake off.
3. To deduct as a discount: took 20 percent off.
4. To carry off or away.
5. Slang
a. To go off; leave: took off in a hurry.
b. To achieve wide use or popularity: a new movie that really took off.
6. To rise into the air or begin flight: The plane took off on time.
7. To discontinue: took off the commuter special.
8. To withhold service due, as from one's work: I'm taking off three days during May.
take on
1. To undertake or begin to handle: took on extra responsibilities.
2. To hire; engage: took on more workers during the harvest.
3. To oppose in competition: a wrestler who took on all comers.
4. Informal To display violent or passionate emotion: Don't take on so!
5. To acquire (an appearance, for example) as or as if one's own: Over the years he has taken on the look of a banker.
take out
1. To extract; remove: took the splinter out.
2. To secure (a license, for example) by application to an authority.
3. Informal To escort, as a date.
4. To give vent to: Don't take your frustration out in such an aggressive manner.
5. To obtain as an equivalent in a different form: took out the money owed in services.
6. Informal To begin a course; set out: The police took out after the thieves.
7. Slang
a. To kill; murder: Two snipers took out an enemy platoon.
b. To search for and destroy in an armed attack or other such encounter: Combat pilots, flying low to avoid radar, took out the guerrilla leader's bunker in a single mission.
take over
1. To assume control, management, or responsibility.
2. To assume the control or management of or the responsibility for: She took over the job after he left.
3. To become dominant: Our defense took over in the second half of the game.
take to
1. To have recourse to; go to, as for safety: took to the woods.
2. To develop as a habit or a steady practice: take to drink.
3. To become fond of or attached to: "Two keen minds that they are, they took to each other" (Jack Kerouac).
take up
1. To raise; lift.
2. To reduce in size; shorten or tighten: take up a gown.
3. To pay off (an outstanding debt, mortgage, or note).
4. To accept (an option, bet, or challenge) as offered.
5. To begin again; resume: Let's take up where we left off.
6. To use up, consume, or occupy: The extra duties took up most of my time.
7. To develop an interest in or devotion to: take up mountain climbing.
8. To deal with: Let's take up each problem one at a time.
9. To assume: took up a friendly attitude.
10. To absorb or adsorb: crops taking up nutrients.
11. To enter into (a profession or business): took up engineering.
Idioms:
on the take Informal
Taking or seeking to take bribes or illegal income: "There were policemen on the take" (Scott Turow).
take a bath Informal
To experience serious financial loss: "Small investors who latched on to hot new issues took a bath in Wall Street" (Paul A. Samuelson).
take account of
To take into consideration.
take away from
To detract from: Drab curtains took away from the otherwise lovely room.
take care
To be careful: Take care or you will slip on the ice.
take care of
To assume responsibility for the maintenance, support, or treatment of.
take charge
To assume control or command.
take effect
1. To become operative, as under law or regulation: The curfew takes effect at midnight.
2. To produce the desired reaction: The antibiotics at last began to take effect.
take exception
To express opposition by argument; object to: took exception to the prosecutor's line of questioning.
take five/ten Slang
To take a short rest or break, as of five or ten minutes.
take for granted
1. To consider as true, real, or forthcoming; anticipate correctly.
2. To underestimate the value of: a publisher who took the editors for granted.
take heart
To be confident or courageous.
take hold
1. To seize, as by grasping.
2. To become established: The newly planted vines quickly took hold.
take it
1. To understand; assume: As I take it, they won't accept the proposal.
2. Informal To endure abuse, criticism, or other harsh treatment: If you can dish it out, you've got to learn to take it.
take it on the chin Slang
To endure punishment, suffering, or defeat.
take it or leave it
To accept or reject unconditionally.
take it out on Informal
To abuse (someone) in venting one's own anger.
take kindly to
1. To be receptive to: take kindly to constructive criticism.
2. To be naturally attracted or fitted to; thrive on.
take lying down Informal
To submit to harsh treatment with no resistance: refused to take the snub lying down.
take notice of
To pay attention to.
take (one's) breath away
To put into a state of awe or shock.
take (one's) time
To act slowly or at one's leisure.
take place
To happen; occur.
take root
1. To become established or fixed.
2. To become rooted.
take shape
To take on a distinctive form.
take sick
Chiefly Southern U.S. To become ill.
take sides
To associate with and support a particular faction, group, cause, or person.
take stock
1. To take an inventory.
2. To make an estimate or appraisal, as of resources or of oneself.
take stock in
To trust, believe in, or attach importance to.
take the bench Law
To assume a judicial position.
take the cake
1. To be the most outrageous or disappointing.
2. To win the prize; be outstanding.
take the count
1. To be defeated.
2. Sports To be counted out in boxing.
take the fall/hit Slang
To incur blame or censure, either willingly or unwillingly: a senior official who took the fall for the failed intelligence operation.
take the floor
To rise to deliver a formal speech, as to an assembly.
take the heat Slang
To incur and endure heavy censure or criticism: had a reputation for being able to take the heat in a crisis.
take to the cleaners Slang
To take all the money or possessions of, especially by outsmarting or swindling.
take up for
To support (a person or group, for example) in an argument.
take up the cudgels
To join in a dispute, especially in defense of a participant.
take up with Informal
To begin to associate with; consort with: took up with a fast crowd.

[Middle English taken, from Old English tacan, from Old Norse taka.]

JungHyunRan09/04/2014 14:45:24
(1)|
take
Từ điển Anh - Anh
take (teɪk) 

v. took, tak•en, tak•ing, 
n. v.t.
1. to get into one's hands or possession by voluntary action: Take the book, please.
2. to hold, grasp, or grip: to take a child by the hand.
3. to get into one's possession or control by force or artifice: took the bone from the snarling dog.
4. to seize or capture: to take a prisoner.
5. to catch or get (fish, game, etc.), esp. by killing.
6. to pick from a number; select.
7. to receive and accept willingly (something given or offered): to take a bribe.
8. to receive or be the recipient of: to take first prize.
9. to accept and act upon or comply with: Take my advice.
10. to receive or accept (a person) into some relation: to take someone in marriage.
11. to receive or react to in a specified manner: She took his death hard.
12. to receive as a payment or charge.
13. to get or obtain from a source; derive: The book takes its title from Dante.
14. to extract or quote.
15. to obtain or exact as compensation for a wrong: to take revenge.
16. to receive into the body, as by swallowing or inhaling: to take a pill; to take a deep breath.
17. to have for one's benefit or use: to take a nap; to take a bath.
18. to use as a flavoring agent: to take sugar in one's coffee.
19. to be subjected to; undergo: to take a rest cure.
20. to endure or submit to with equanimity or without weakening: unable to take punishment.
21. to enter into the enjoyment of: Let's take a vacation.
22. to carry off without permission; steal: to take someone's wallet.
23. to remove: to take a coat from the closet.
24. to remove by death: The flood took many victims.
25. to subtract or deduct: to take 2 from 5.
26. to carry with one: Are you taking an umbrella?
27. to convey or transport: We took them for a drive.
28. to serve as a means of conducting: These stairs take you to the attic.
29. to bring about a change in the condition of: Her talent took her to the top.
30. to escort or accompany.
31. to attempt or succeed in getting over, through, or around; clear; negotiate: The horse took the fence easily.
32. to come upon suddenly; catch: to take a thief by surprise.
33. to attack or affect with or as if with a disease: taken with a fit of laughter.
34. to be capable of attaining as a result of some action or treatment: This leather takes a high polish.
35. to absorb or become impregnated with; be susceptible to: The cloth will not take a dye.
36. to require: It takes courage to do that.
37. to employ for some purpose: to take measures to curb drugs.
38. to use as a means of transportation: to take the bus to work.
39. to proceed to occupy: Take a seat.
40. to fill (time, space, etc.); occupy: His hobby takes most of his spare time.
41. to use up; consume: It took ten minutes to solve the problem.
42. to avail oneself of: I took the opportunity to leave.
43. to do, perform, execute, etc.: to take a walk.
44. to go into or enter: Take the road to the left.
45. to adopt and enter upon (a way, course, etc.): to take the path of least resistance.
46. to act or perform: to take the part of the hero.
47. to make (a reproduction, picture, or photograph): to take home movies.
48. to make a picture, esp. a photograph, of: The photographer took us sitting down.
49. to write down: to take notes.
50. to apply oneself to; study: to take a history course.
51. to deal with; treat: to take a matter under consideration.
52. to assume or undertake (a function, duty, etc.): The mayor took office last month.
53. to assume or adopt (a symbol, badge, etc.) as a token of office: to take the veil.
54. to assume the obligation of; be bound by: to take an oath.
55. to assume or adopt as one's own: to take someone's side in an argument.
56. to accept the burden of: to take the blame.
57. to determine by inquiry, examination, measurement, etc.: to take someone's pulse; to take a census.
58. to have or experience (a feeling or state of mind): to take pride in one's appearance.
59. to form and hold in the mind: to take a gloomy view.
60. to grasp or apprehend mentally; understand: Do you take my meaning?
61. to understand in a specified way: Don't take the remark as an insult.
62. to accept the statements of: She took him at his word.
63. to assume as a fact: I take it that you won't be there.
64. to regard or consider: They were taken to be wealthy.
65. to consider as an example: Take the French Revolution.
66. to capture or win (a piece, trick, etc.) in a game.
67. Informal. to cheat, swindle, or victimize: The museum got taken on that painting.
68. to win or obtain money from: He took me for $10 in the poker game.
69. to have sexual intercourse with.
70. to be used with (a certain grammatical form, accent, case, etc.): a verb that takes an object.
71. Law. to acquire (property), as on the happening of a particular event.
72. (of a baseball batter) to allow (a pitch) to go by without swinging at it.
v.i.
73. to catch or engage, as a mechanical device.
74. to strike root or begin to grow, as a plant.
75. to adhere, as ink, dye, or color.
76. to win favor or acceptance.
77. to have the intended result or effect: The vaccination took.
78. to enter into possession, as of an estate.
79. to detract (usu. fol. by from).
80. to make one's way; proceed; go: to take across the meadow.
81. to fall or become: to take sick.
82. to admit of being photographed in a particular manner.
83. take after,
a. to resemble (another person, as a parent).
b. to follow or chase.
84. take apart,
a. to disassemble: to take a clock apart.
b. to criticize severely; attack.
c. to examine or analyze closely; dissect.
85. take back,
a. to regain possession of.
b. to return, as for exchange.
c. to allow to return; resume a relationship with.
d. to cause to remember: It takes me back to the old days.
e. to retract: to take back a statement.
86. take down,
a. to write down; record.
b. to reduce the pride or arrogance of; humble: to take someone down a peg.
87. take in,
a. to alter (a garment) so as to make smaller or tighter.
b. to provide lodging for.
c. to include; encompass.
d. to grasp the meaning of; comprehend.
e. to deceive; trick; cheat.
f. to observe; notice.
g. to visit or attend: to take in a show.
h. to furl (a sail).
i. to receive as proceeds, as from business activity.
88. take off,
a. to remove: Take off your coat.
b. to lead away.
c. to leave the ground, as an airplane.
d. to depart; leave.
e. to move onward or forward with a burst of speed.
f. to withdraw or remove from: She was taken off the night shift.
g. to subtract, as a discount; deduct: The store took off 20 percent.
h. to imitate; mimic; burlesque.
i. to achieve sudden, marked growth, success, etc.: Sales took off just before Christmas.
89. take on,
a. to hire; employ.
b. to undertake; assume.
c. to acquire.
d. to accept as a challenge or opponent.
e. Informal. to show great emotion; become excited.
90. take out,
a. to withdraw; remove.
b. to deduct.
c. to procure by application: to take out insurance.
d. to carry out for use or consumption elsewhere.
e. to escort, as on a date.
f. to set out; start.
g. Slang. to kill or destroy.
91. take over, to assume management or possession of or responsibility for.
92. take up,
a. to occupy oneself with the study or practice of.
b. to lift or pick up.
c. to fill, occupy, or consume (space, time, etc.).
d. to begin to advocate or support; sponsor.
e. to continue; resume.
f. to raise for discussion or consideration.
g. to undertake; assume.
h. to absorb (a liquid).
i. to make shorter, as by hemming.
j. to make tighter, as by winding in.
k. to deal with.
l. to adopt seriously: to take up an idea.
m. to accept, as an offer or challenge.
93. take up with, to become friendly with; keep company with.
n.
94. the act of taking.
95. something that is taken.
96. the quantity of fish, game, etc., taken at one time.
97. Informal. money taken in, esp. profits.
98.
a. a scene in a movie or television program photographed without interruption.
b. an instance of such continuous operation of a film camera.
99. Informal. a visual and mental response: She did a slow take.
100. a recording of a musical performance.
101. a successful inoculation.
102.
a. an opinion or assessment: What's your take on the candidate?
b. an approach; treatment: a new take on an old idea.
Idioms:
1. on the take, Slang.
a. accepting bribes.
b. in search of personal profit at the expense of others.
2. take five, ten, etc., Informal. to rest briefly, esp. for the approximate time specified.
3. take for,
a. to assume to be: I took it for a fact.
b. to assume falsely to be; mistake for: to be taken for a foreigner.
4. take it,
a. to believe, assume, or accept something: Take it from me.
b. to be able to resist or endure hardship, abuse, etc.
5. take it out on, to cause (another) to suffer for one's own misfortune, frustration, anger, etc.
6. take place, to happen; occur.
7. take to,
a. to devote or apply oneself to: to take to drink.
b. to respond favorably to: They took to each other at once.
c. to go to: to take to one's bed.
d. to have recourse to; resort to.
8. take upon oneself, to assume as a responsibility or obligation.